Lineage for d4nypa_ (4nyp A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557585Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2557586Protein Cut A1 [89931] (5 species)
  7. 2557614Species Pyrococcus horikoshii [TaxId:53953] [102974] (10 PDB entries)
    Uniprot O58720
  8. 2557645Domain d4nypa_: 4nyp A: [230304]
    automated match to d1ukua_
    complexed with na, so4

Details for d4nypa_

PDB Entry: 4nyp (more details), 2 Å

PDB Description: The 2.0 Angstrom Crystal Structure of Pyrococcus Horikoshii Cuta1 Complexed With NA+
PDB Compounds: (A:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d4nypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nypa_ d.58.5.2 (A:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]}
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

SCOPe Domain Coordinates for d4nypa_:

Click to download the PDB-style file with coordinates for d4nypa_.
(The format of our PDB-style files is described here.)

Timeline for d4nypa_: