Lineage for d4nbzb_ (4nbz B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520459Species Llama (Lama glama) [TaxId:9844] [189241] (5 PDB entries)
  8. 1520460Domain d4nbzb_: 4nbz B: [230292]
    automated match to d4nbzd_

Details for d4nbzb_

PDB Entry: 4nbz (more details), 1.75 Å

PDB Description: Crystal Structure of TcdA-A1 Bound to A26.8 VHH
PDB Compounds: (B:) a26.8 vhh

SCOPe Domain Sequences for d4nbzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbzb_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyya
dsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqvt
vssgseqklise

SCOPe Domain Coordinates for d4nbzb_:

Click to download the PDB-style file with coordinates for d4nbzb_.
(The format of our PDB-style files is described here.)

Timeline for d4nbzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4nbzd_