![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (23 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [189241] (4 PDB entries) |
![]() | Domain d4nbzb_: 4nbz B: [230292] automated match to d4nbzd_ |
PDB Entry: 4nbz (more details), 1.75 Å
SCOPe Domain Sequences for d4nbzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nbzb_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]} vkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyya dsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqvt vssgseqklise
Timeline for d4nbzb_: