Lineage for d1ocrb1 (1ocr B:91-227)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56165Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 56166Protein Cytochrome c oxidase [49544] (3 species)
  7. 56167Species Cow (Bos taurus) [TaxId:9913] [49545] (5 PDB entries)
  8. 56170Domain d1ocrb1: 1ocr B:91-227 [23029]
    Other proteins in same PDB: d1ocra1, d1ocrb2, d1ocrc1, d1ocrd1, d1ocre_, d1ocrf_, d1ocrg1, d1ocrh_, d1ocri1, d1ocrj1, d1ocrk1, d1ocrl1, d1ocrm1, d1ocrn1, d1ocro2, d1ocrp1, d1ocrq1, d1ocrr_, d1ocrs_, d1ocrt1, d1ocru_, d1ocrv1, d1ocrw1, d1ocrx1, d1ocry1, d1ocrz1

Details for d1ocrb1

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (B:)

SCOP Domain Sequences for d1ocrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrb1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d1ocrb1:

Click to download the PDB-style file with coordinates for d1ocrb1.
(The format of our PDB-style files is described here.)

Timeline for d1ocrb1: