Lineage for d4nbla_ (4nbl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2101162Family c.17.1.0: automated matches [191651] (1 protein)
    not a true family
  6. 2101163Protein automated matches [191201] (1 species)
    not a true protein
  7. 2101164Species Human (Homo sapiens) [TaxId:9606] [189525] (14 PDB entries)
  8. 2101169Domain d4nbla_: 4nbl A: [230288]
    automated match to d4n5db_
    complexed with 2j6, po4

Details for d4nbla_

PDB Entry: 4nbl (more details), 1.76 Å

PDB Description: Tailoring Small Molecules for an Allosteric Site on Procaspase-6
PDB Compounds: (A:) Caspase-6

SCOPe Domain Sequences for d4nbla_:

Sequence, based on SEQRES records: (download)

>d4nbla_ c.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afykremfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgf
evkcfndlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglf
kgdkchslvgkpkifiiqaargnqhdvpvipldvvdnqtekldtnitevdaasvytlpag
adflmcysvaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkvsqrrvdf
ckdpsaigkkqvpcfasmltkklhffpks

Sequence, based on observed residues (ATOM records): (download)

>d4nbla_ c.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afykremfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgf
evkcfndlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglf
kgdkchslvgkpkifiiqaargnqhdvpvipdtnitevdaasvytlpagadflmcysvae
gyyshretvngswyiqdlcemlgkygssleftelltlvnrkvsqrrvdfckdpsaigkkq
vpcfasmltkklhffpks

SCOPe Domain Coordinates for d4nbla_:

Click to download the PDB-style file with coordinates for d4nbla_.
(The format of our PDB-style files is described here.)

Timeline for d4nbla_: