Lineage for d4n5zw_ (4n5z W:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1305775Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)
  8. 1306033Domain d4n5zw_: 4n5z W: [230287]
    automated match to d4n5ze_
    complexed with nag; mutant

Details for d4n5zw_

PDB Entry: 4n5z (more details), 2.95 Å

PDB Description: crystal structure of aerosol transmissible influenza h5 hemagglutinin mutant (n158d, n224k, q226l and t318i) from the influenza virus a/viet nam/1203/2004 (h5n1)
PDB Compounds: (W:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4n5zw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5zw_ b.19.1.2 (W:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
tigecpkyvksnrlvlaiglrnsp

SCOPe Domain Coordinates for d4n5zw_:

Click to download the PDB-style file with coordinates for d4n5zw_.
(The format of our PDB-style files is described here.)

Timeline for d4n5zw_: