Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (7 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries) |
Domain d4n5zu_: 4n5z U: [230285] Other proteins in same PDB: d4n5zb_, d4n5zd_, d4n5zf_, d4n5zh_, d4n5zj_, d4n5zl_, d4n5zn_, d4n5zp_, d4n5zr_, d4n5zt_, d4n5zv_, d4n5zx_, d4n5zz_ automated match to d4n5ze_ complexed with nag; mutant |
PDB Entry: 4n5z (more details), 2.95 Å
SCOPe Domain Sequences for d4n5zu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n5zu_ b.19.1.2 (U:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl tigecpkyvksnrlvlaiglrnsp
Timeline for d4n5zu_: