Lineage for d4n27f_ (4n27 F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329958Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1329959Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1330233Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 1330234Protein automated matches [190967] (25 species)
    not a true protein
  7. 1330252Species Brucella abortus [TaxId:359391] [229708] (1 PDB entry)
  8. 1330258Domain d4n27f_: 4n27 F: [230271]
    automated match to d4n27c_
    complexed with pe5, zn

Details for d4n27f_

PDB Entry: 4n27 (more details), 2.73 Å

PDB Description: X-ray structure of Brucella abortus RicA
PDB Compounds: (F:) Bacterial transferase hexapeptide repeat

SCOPe Domain Sequences for d4n27f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n27f_ b.81.1.0 (F:) automated matches {Brucella abortus [TaxId: 359391]}
mpiyaynghkpqfadresnwiapdatligkvvvgenagfwfgavlrgdnepitigadtnv
qeqtimhtdigfpltigagctighrailhgctigentligmgaivlngakvgkncligag
tlvkegmeipdnslvvgsparvlrqlddaaveklrasakhyverghsfmrgmepa

SCOPe Domain Coordinates for d4n27f_:

Click to download the PDB-style file with coordinates for d4n27f_.
(The format of our PDB-style files is described here.)

Timeline for d4n27f_: