Lineage for d4mkna_ (4mkn A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1336839Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1337170Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 1337171Protein automated matches [190605] (13 species)
    not a true protein
  7. 1337185Species Chlamydomonas reinhardtii [TaxId:3055] [230267] (1 PDB entry)
  8. 1337186Domain d4mkna_: 4mkn A: [230268]
    automated match to d4ff7a_
    complexed with mpd, mrd

Details for d4mkna_

PDB Entry: 4mkn (more details), 1.1 Å

PDB Description: Crystal structure of chloroplastic triosephosphate isomerase from Chlamydomonas reinhardtii at 1.1 A of resolution
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4mkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mkna_ c.1.1.0 (A:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
ssakffvggnwkcngsvanvaklvdelnagtiprgvdvvvappfiyidyvmqhldrdkyq
lsaqnawiggngaftgevsaeqltdfgvpwvilghserrslfgesnevvakktshalaag
lgviacigetleqrnsgsvfkvldaqmdalvdevkdwtkvvlayepvwaigtgvvaspeq
aqevhaylrqycakklgaavadklriiyggsvsdtnckdlskqedidgflvggaslkgaa
fvticnaagpkakp

SCOPe Domain Coordinates for d4mkna_:

Click to download the PDB-style file with coordinates for d4mkna_.
(The format of our PDB-style files is described here.)

Timeline for d4mkna_: