SCOPe 2.03: Domain d4l2xf_: 4l2x F:

Lineage for d4l2xf_ (4l2x F:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (34 PDB entries)

8. Domain d4l2xf_: 4l2x F: [230260]
   automated match to d4demf_
   complexed with mg, pop, yl2

Details for d4l2xf_

PDB Entry: 4l2x, 2.55 Å

PDB Description: Crystal structure of human FPPS in complex with magnesium, CL02134, and inorganic pyrophosphate

PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4l2xf_:

Sequence; same for both SEQRES and ATOM records:

>d4l2xf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk

Timeline for d4l2xf_:

• d4l2xf_ is new in SCOPe 2.03-stable
  
• d4l2xf_ appears in SCOPe 2.04
  
• d4l2xf_ appears in the current release, SCOPe 2.08