Lineage for d4ilqa_ (4ilq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971826Species Chlamydia trachomatis [TaxId:471472] [230253] (2 PDB entries)
  8. 2971835Domain d4ilqa_: 4ilq A: [230254]
    automated match to d3u53c_
    complexed with gol, so4

Details for d4ilqa_

PDB Entry: 4ilq (more details), 2.6 Å

PDB Description: 2.60a resolution structure of ct771 from chlamydia trachomatis
PDB Compounds: (A:) ct771

SCOPe Domain Sequences for d4ilqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ilqa_ d.113.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 471472]}
tkheysfgvipirffgtpdrstlkacfichtdgkhwgfpkghaeekegpqeaaerelvee
tglgivnffpkifvenysfndkeeifvrkevtyflaevkgevhadpdeicdvqwlsfqeg
lrllnfpeirnivteadkfvqsylfas

SCOPe Domain Coordinates for d4ilqa_:

Click to download the PDB-style file with coordinates for d4ilqa_.
(The format of our PDB-style files is described here.)

Timeline for d4ilqa_: