Lineage for d4ia0a_ (4ia0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2015191Protein automated matches [190370] (1 species)
    not a true protein
  7. 2015192Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)
  8. 2015210Domain d4ia0a_: 4ia0 A: [230251]
    automated match to d3tsea_
    complexed with 5bb, mg, zn

Details for d4ia0a_

PDB Entry: 4ia0 (more details), 2.17 Å

PDB Description: Crystal structure of the PDE5A1 catalytic domain in complex with novel inhibitors
PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d4ia0a_:

Sequence, based on SEQRES records: (download)

>d4ia0a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
vsedcfplldgcrknrqkwqalae

Sequence, based on observed residues (ATOM records): (download)

>d4ia0a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
ldhrgvnnsqlychsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatd
lalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvat
effdnkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalae

SCOPe Domain Coordinates for d4ia0a_:

Click to download the PDB-style file with coordinates for d4ia0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ia0a_: