SCOP 1.65: Domain d1fftb1: 1fft B:118-283

Lineage for d1fftb1 (1fft B:118-283)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Quinol oxidase (CyoA) [49542] (1 species)

7. Species Escherichia coli [TaxId:562] [49543] (3 PDB entries)

8. Domain d1fftb1: 1fft B:118-283 [23025]
   Other proteins in same PDB: d1ffta_, d1fftb2, d1fftc_, d1fftf_, d1fftg2, d1ffth_

Details for d1fftb1

PDB Entry: 1fft

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftb1:

Sequence; same for both SEQRES and ATOM records:

>d1fftb1 b.6.1.2 (B:118-283) Quinol oxidase (CyoA) {Escherichia coli}
kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip
rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak
akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfma

Timeline for d1fftb1:

• d1fftb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fftb1 appears in SCOP 1.63
  
• d1fftb1 appears in SCOP 1.67
  
• d1fftb1 appears in the current release, SCOPe 2.08