SCOPe 2.05: Domain d4ht3b_: 4ht3 B:

Lineage for d4ht3b_ (4ht3 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (4 species)

7. Species Salmonella enterica [TaxId:90371] [229810] (5 PDB entries)

8. Domain d4ht3b_: 4ht3 B: [230249]
   Other proteins in same PDB: d4ht3a_
   automated match to d1kfjb_
   complexed with bcn, cl, cs, edo, f9f, peg, pg5, pge, plp

Details for d4ht3b_

PDB Entry: 4ht3, 1.3 Å

PDB Description: the crystal structure of salmonella typhimurium tryptophan synthase at 1.30a complexed with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino- 1-ethylphosphate (f9) inhibitor in the alpha site, internal aldimine

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d4ht3b_:

Sequence; same for both SEQRES and ATOM records:

>d4ht3b_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkar

Timeline for d4ht3b_:

• d4ht3b_ first appeared in SCOPe 2.03
  
• d4ht3b_ appears in SCOPe 2.04
  
• d4ht3b_ appears in SCOPe 2.06
  
• d4ht3b_ appears in the current release, SCOPe 2.08