Lineage for d4ht3b_ (4ht3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139947Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2139964Species Salmonella enterica [TaxId:90371] [229810] (5 PDB entries)
  8. 2139965Domain d4ht3b_: 4ht3 B: [230249]
    Other proteins in same PDB: d4ht3a_
    automated match to d1kfjb_
    complexed with bcn, cl, cs, edo, f9f, peg, pg5, pge, plp

Details for d4ht3b_

PDB Entry: 4ht3 (more details), 1.3 Å

PDB Description: the crystal structure of salmonella typhimurium tryptophan synthase at 1.30a complexed with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9) inhibitor in the alpha site, internal aldimine
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d4ht3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ht3b_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkar

SCOPe Domain Coordinates for d4ht3b_:

Click to download the PDB-style file with coordinates for d4ht3b_.
(The format of our PDB-style files is described here.)

Timeline for d4ht3b_: