Lineage for d4ilya_ (4ily A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533598Family d.2.1.7: Chitosanase [53996] (2 proteins)
    automatically mapped to Pfam PF01374
  6. 2533607Protein automated matches [230243] (3 species)
    not a true protein
  7. 2533614Species Streptomyces sp. [TaxId:862751] [230244] (1 PDB entry)
  8. 2533615Domain d4ilya_: 4ily A: [230247]
    Other proteins in same PDB: d4ilyb2
    automated match to d1chka_

Details for d4ilya_

PDB Entry: 4ily (more details), 1.84 Å

PDB Description: abundantly secreted chitosanase from streptomyces sp. sirexaa-e
PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d4ilya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ilya_ d.2.1.7 (A:) automated matches {Streptomyces sp. [TaxId: 862751]}
atglddpakkdiamqlvssaenstldwkaqygyiedigdgrgytagiigfcsgtgdmlal
verytdrspgnvlasylpalrevdgtdshdgldpgfprdwaeaakdpvfqqaqnderdrv
yfdpavrqakddglgtlgqfayydaivmhggggdstsfgsirqralaeaeppsrggdeva
yldafldarvwamrqeeahsdtsrvdtaqrvflrdgnlnldppldwqvygdsfhig

SCOPe Domain Coordinates for d4ilya_:

Click to download the PDB-style file with coordinates for d4ilya_.
(The format of our PDB-style files is described here.)

Timeline for d4ilya_: