SCOPe 2.04: Domain d4ilya_: 4ily A:

Lineage for d4ilya_ (4ily A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.7: Chitosanase [53996] (2 proteins)
   automatically mapped to Pfam PF01374

6. Protein automated matches [230243] (2 species)
   not a true protein

7. Species Streptomyces sp. [TaxId:862751] [230244] (1 PDB entry)

8. Domain d4ilya_: 4ily A: [230247]
   automated match to d1chka_

Details for d4ilya_

PDB Entry: 4ily, 1.83 Å

PDB Description: abundantly secreted chitosanase from streptomyces sp. sirexaa-e

PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d4ilya_:

Sequence; same for both SEQRES and ATOM records:

>d4ilya_ d.2.1.7 (A:) automated matches {Streptomyces sp. [TaxId: 862751]}
atglddpakkdiamqlvssaenstldwkaqygyiedigdgrgytagiigfcsgtgdmlal
verytdrspgnvlasylpalrevdgtdshdgldpgfprdwaeaakdpvfqqaqnderdrv
yfdpavrqakddglgtlgqfayydaivmhggggdstsfgsirqralaeaeppsrggdeva
yldafldarvwamrqeeahsdtsrvdtaqrvflrdgnlnldppldwqvygdsfhig

Timeline for d4ilya_:

• d4ilya_ first appeared in SCOPe 2.03
  
• d4ilya_ appears in SCOPe 2.05
  
• d4ilya_ appears in the current release, SCOPe 2.08