Lineage for d4ilyb_ (4ily B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1888833Family d.2.1.7: Chitosanase [53996] (2 proteins)
    automatically mapped to Pfam PF01374
  6. 1888841Protein automated matches [230243] (3 species)
    not a true protein
  7. 1888848Species Streptomyces sp. [TaxId:862751] [230244] (1 PDB entry)
  8. 1888850Domain d4ilyb_: 4ily B: [230246]
    automated match to d1chka_

Details for d4ilyb_

PDB Entry: 4ily (more details), 1.83 Å

PDB Description: abundantly secreted chitosanase from streptomyces sp. sirexaa-e
PDB Compounds: (B:) Chitosanase

SCOPe Domain Sequences for d4ilyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ilyb_ d.2.1.7 (B:) automated matches {Streptomyces sp. [TaxId: 862751]}
saptqpaahhleaaatglddpakkdiamqlvssaenstldwkaqygyiedigdgrgytag
iigfcsgtgdmlalverytdrspgnvlasylpalrevdgtdshdgldpgfprdwaeaakd
pvfqqaqnderdrvyfdpavrqakddglgtlgqfayydaivmhggggdstsfgsirqral
aeaeppsrggdevayldafldarvwamrqeeahsdtsrvdtaqrvflrdgnlnldppldw
qvygdsfhig

SCOPe Domain Coordinates for d4ilyb_:

Click to download the PDB-style file with coordinates for d4ilyb_.
(The format of our PDB-style files is described here.)

Timeline for d4ilyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ilya_