![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.7: Chitosanase [53996] (2 proteins) automatically mapped to Pfam PF01374 |
![]() | Protein automated matches [230243] (2 species) not a true protein |
![]() | Species Streptomyces sp. [TaxId:862751] [230244] (1 PDB entry) |
![]() | Domain d4ilyb_: 4ily B: [230246] automated match to d1chka_ |
PDB Entry: 4ily (more details), 1.83 Å
SCOPe Domain Sequences for d4ilyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ilyb_ d.2.1.7 (B:) automated matches {Streptomyces sp. [TaxId: 862751]} saptqpaahhleaaatglddpakkdiamqlvssaenstldwkaqygyiedigdgrgytag iigfcsgtgdmlalverytdrspgnvlasylpalrevdgtdshdgldpgfprdwaeaakd pvfqqaqnderdrvyfdpavrqakddglgtlgqfayydaivmhggggdstsfgsirqral aeaeppsrggdevayldafldarvwamrqeeahsdtsrvdtaqrvflrdgnlnldppldw qvygdsfhig
Timeline for d4ilyb_: