Lineage for d4gv8f_ (4gv8 F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332308Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1332444Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1332637Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1332638Protein automated matches [191182] (7 species)
    not a true protein
  7. 1332791Species Staphylococcus phage [TaxId:12360] [227850] (1 PDB entry)
  8. 1332797Domain d4gv8f_: 4gv8 F: [230239]
    automated match to d4gv8e_
    complexed with dup, mg

Details for d4gv8f_

PDB Entry: 4gv8 (more details), 2.1 Å

PDB Description: dutpase from phage phi11 of s.aureus: visualization of the species- specific insert
PDB Compounds: (F:) dutpase

SCOPe Domain Sequences for d4gv8f_:

Sequence, based on SEQRES records: (download)

>d4gv8f_ b.85.4.0 (F:) automated matches {Staphylococcus phage [TaxId: 12360]}
ntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgllt
srsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdairq
ygtyqinegdklaqlvivpiwtpelkqveefesvsergekgf

Sequence, based on observed residues (ATOM records): (download)

>d4gv8f_ b.85.4.0 (F:) automated matches {Staphylococcus phage [TaxId: 12360]}
ntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgllt
srsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdairq
ygtyqinegdklaqlvivpiwtpelkqveefef

SCOPe Domain Coordinates for d4gv8f_:

Click to download the PDB-style file with coordinates for d4gv8f_.
(The format of our PDB-style files is described here.)

Timeline for d4gv8f_: