Lineage for d4gv8a_ (4gv8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818270Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2818271Protein automated matches [191182] (20 species)
    not a true protein
  7. 2818485Species Staphylococcus phage [TaxId:12360] [227850] (3 PDB entries)
  8. 2818486Domain d4gv8a_: 4gv8 A: [230238]
    automated match to d4gv8e_
    complexed with dup, mg

Details for d4gv8a_

PDB Entry: 4gv8 (more details), 2.1 Å

PDB Description: dutpase from phage phi11 of s.aureus: visualization of the species- specific insert
PDB Compounds: (A:) dutpase

SCOPe Domain Sequences for d4gv8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gv8a_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 12360]}
ntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgllt
srsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdairq
ygtyqinegdklaqlvivpiwtpelkqveefes

SCOPe Domain Coordinates for d4gv8a_:

Click to download the PDB-style file with coordinates for d4gv8a_.
(The format of our PDB-style files is described here.)

Timeline for d4gv8a_: