| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein Cell-division protein FtsZ [55309] (9 species) |
| Species Staphylococcus aureus [TaxId:1280] [226387] (4 PDB entries) |
| Domain d3wgma2: 3wgm A:207-312 [230217] Other proteins in same PDB: d3wgma1, d3wgmb1 automated match to d4dxda2 complexed with gtp, mg; mutant |
PDB Entry: 3wgm (more details), 2.09 Å
SCOPe Domain Sequences for d3wgma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wgma2 d.79.2.1 (A:207-312) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatg
Timeline for d3wgma2: