Lineage for d3wgma2 (3wgm A:207-312)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565737Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2565786Species Staphylococcus aureus [TaxId:1280] [226387] (4 PDB entries)
  8. 2565788Domain d3wgma2: 3wgm A:207-312 [230217]
    Other proteins in same PDB: d3wgma1, d3wgmb1
    automated match to d4dxda2
    complexed with gtp, mg; mutant

Details for d3wgma2

PDB Entry: 3wgm (more details), 2.09 Å

PDB Description: staphylococcus aureus ftsz t7 mutant substituted for gan bound with gtp, deltat7gan-gtp
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d3wgma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgma2 d.79.2.1 (A:207-312) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatg

SCOPe Domain Coordinates for d3wgma2:

Click to download the PDB-style file with coordinates for d3wgma2.
(The format of our PDB-style files is described here.)

Timeline for d3wgma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wgma1