Lineage for d3wgja1 (3wgj A:12-208)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843636Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1843685Species Staphylococcus aureus [TaxId:1280] [226386] (4 PDB entries)
  8. 1843689Domain d3wgja1: 3wgj A:12-208 [230215]
    Other proteins in same PDB: d3wgja2
    automated match to d4dxda1
    complexed with ca; mutant

Details for d3wgja1

PDB Entry: 3wgj (more details), 2.18 Å

PDB Description: staphylococcus aureus ftsz t7 chimera mutant, t7bs
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d3wgja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgja1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliatpglin

SCOPe Domain Coordinates for d3wgja1:

Click to download the PDB-style file with coordinates for d3wgja1.
(The format of our PDB-style files is described here.)

Timeline for d3wgja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wgja2
View in 3D
Domains from other chains:
(mouse over for more information)
d3wgjb1