Lineage for d3wgma1 (3wgm A:12-206)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843636Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1843685Species Staphylococcus aureus [TaxId:1280] [226386] (4 PDB entries)
  8. 1843687Domain d3wgma1: 3wgm A:12-206 [230214]
    Other proteins in same PDB: d3wgma2, d3wgmb2
    automated match to d4dxda1
    complexed with gtp, mg; mutant

Details for d3wgma1

PDB Entry: 3wgm (more details), 2.09 Å

PDB Description: staphylococcus aureus ftsz t7 mutant substituted for gan bound with gtp, deltat7gan-gtp
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d3wgma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgma1 c.32.1.1 (A:12-206) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavgan

SCOPe Domain Coordinates for d3wgma1:

Click to download the PDB-style file with coordinates for d3wgma1.
(The format of our PDB-style files is described here.)

Timeline for d3wgma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wgma2