![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Cell-division protein FtsZ [52492] (9 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [226386] (4 PDB entries) |
![]() | Domain d3wgma1: 3wgm A:12-206 [230214] Other proteins in same PDB: d3wgma2, d3wgmb2 automated match to d4dxda1 complexed with gtp, mg; mutant |
PDB Entry: 3wgm (more details), 2.09 Å
SCOPe Domain Sequences for d3wgma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wgma1 c.32.1.1 (A:12-206) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]} atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr qgvqgisdliavgan
Timeline for d3wgma1: