SCOPe 2.06: Domain d3wgnb2: 3wgn B:209-315

Lineage for d3wgnb2 (3wgn B:209-315)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries)

8. Domain d3wgnb2: 3wgn B:209-315 [230213]
   Other proteins in same PDB: d3wgna1, d3wgnb1
   automated match to d3vo8a2
   complexed with gsp

Details for d3wgnb2

PDB Entry: 3wgn, 2.61 Å

PDB Description: staphylococcus aureus ftsz bound with gtp-gamma-s

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wgnb2:

Sequence; same for both SEQRES and ATOM records:

>d3wgnb2 d.79.2.1 (B:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

Timeline for d3wgnb2:

• d3wgnb2 first appeared in SCOPe 2.03
  
• d3wgnb2 appears in SCOPe 2.05
  
• d3wgnb2 appears in SCOPe 2.07
  
• d3wgnb2 appears in the current release, SCOPe 2.08