Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Cell-division protein FtsZ [55309] (9 species) |
Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries) |
Domain d3wgnb2: 3wgn B:209-315 [230213] Other proteins in same PDB: d3wgna1, d3wgnb1 automated match to d3vo8a2 complexed with gsp |
PDB Entry: 3wgn (more details), 2.61 Å
SCOPe Domain Sequences for d3wgnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wgnb2 d.79.2.1 (B:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]} ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf
Timeline for d3wgnb2: