Lineage for d3wgnb2 (3wgn B:209-315)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420833Protein Cell-division protein FtsZ [55309] (9 species)
  7. 1420889Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries)
  8. 1420903Domain d3wgnb2: 3wgn B:209-315 [230213]
    Other proteins in same PDB: d3wgna1, d3wgnb1
    automated match to d3vo8a2
    complexed with gsp

Details for d3wgnb2

PDB Entry: 3wgn (more details), 2.61 Å

PDB Description: staphylococcus aureus ftsz bound with gtp-gamma-s
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wgnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgnb2 d.79.2.1 (B:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d3wgnb2:

Click to download the PDB-style file with coordinates for d3wgnb2.
(The format of our PDB-style files is described here.)

Timeline for d3wgnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wgnb1