SCOPe 2.05: Domain d3wgka2: 3wgk A:207-314

Lineage for d3wgka2 (3wgk A:207-314)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Staphylococcus aureus [TaxId:1280] [226387] (4 PDB entries)

8. Domain d3wgka2: 3wgk A:207-314 [230207]
   Other proteins in same PDB: d3wgka1, d3wgkb1
   automated match to d4dxda2
   complexed with gdp; mutant

Details for d3wgka2

PDB Entry: 3wgk, 2.8 Å

PDB Description: staphylococcus aureus ftsz t7 mutant substituted for gag, deltat7gag- gdp

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d3wgka2:

Sequence; same for both SEQRES and ATOM records:

>d3wgka2 d.79.2.1 (A:207-314) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfd

Timeline for d3wgka2:

• d3wgka2 first appeared in SCOPe 2.03
  
• d3wgka2 appears in SCOPe 2.04
  
• d3wgka2 appears in SCOPe 2.06
  
• d3wgka2 appears in the current release, SCOPe 2.08