Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein Cell-division protein FtsZ [52492] (9 species) |
Species Staphylococcus aureus [TaxId:1280] [226386] (4 PDB entries) |
Domain d3wgka1: 3wgk A:11-206 [230206] Other proteins in same PDB: d3wgka2, d3wgkb2 automated match to d4dxda1 complexed with gdp; mutant |
PDB Entry: 3wgk (more details), 2.8 Å
SCOPe Domain Sequences for d3wgka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wgka1 c.32.1.1 (A:11-206) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]} latlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglg aganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvg vvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvl rqgvqgisdliavgag
Timeline for d3wgka1: