Lineage for d3wgkb2 (3wgk B:207-314)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201406Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2201455Species Staphylococcus aureus [TaxId:1280] [226387] (4 PDB entries)
  8. 2201461Domain d3wgkb2: 3wgk B:207-314 [230205]
    Other proteins in same PDB: d3wgka1, d3wgkb1
    automated match to d4dxda2
    complexed with gdp; mutant

Details for d3wgkb2

PDB Entry: 3wgk (more details), 2.8 Å

PDB Description: staphylococcus aureus ftsz t7 mutant substituted for gag, deltat7gag- gdp
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wgkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgkb2 d.79.2.1 (B:207-314) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfd

SCOPe Domain Coordinates for d3wgkb2:

Click to download the PDB-style file with coordinates for d3wgkb2.
(The format of our PDB-style files is described here.)

Timeline for d3wgkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wgkb1