Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Cell-division protein FtsZ [55309] (9 species) |
Species Staphylococcus aureus [TaxId:1280] [226387] (4 PDB entries) |
Domain d3wgkb2: 3wgk B:207-314 [230205] Other proteins in same PDB: d3wgka1, d3wgkb1 automated match to d4dxda2 complexed with gdp; mutant |
PDB Entry: 3wgk (more details), 2.8 Å
SCOPe Domain Sequences for d3wgkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wgkb2 d.79.2.1 (B:207-314) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]} ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfd
Timeline for d3wgkb2: