Lineage for d3wgkb1 (3wgk B:11-206)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592224Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592225Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1592226Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1592227Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1592276Species Staphylococcus aureus [TaxId:1280] [226386] (4 PDB entries)
  8. 1592283Domain d3wgkb1: 3wgk B:11-206 [230204]
    Other proteins in same PDB: d3wgka2, d3wgkb2
    automated match to d4dxda1
    complexed with gdp; mutant

Details for d3wgkb1

PDB Entry: 3wgk (more details), 2.8 Å

PDB Description: staphylococcus aureus ftsz t7 mutant substituted for gag, deltat7gag- gdp
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wgkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgkb1 c.32.1.1 (B:11-206) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
latlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglg
aganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvg
vvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvl
rqgvqgisdliavgag

SCOPe Domain Coordinates for d3wgkb1:

Click to download the PDB-style file with coordinates for d3wgkb1.
(The format of our PDB-style files is described here.)

Timeline for d3wgkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wgkb2