SCOPe 2.05: Domain d3wama_: 3wam A:

Lineage for d3wama_ (3wam A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (45 PDB entries)

8. Domain d3wama_: 3wam A: [230200]
   automated match to d3vtva_
   complexed with cit

Details for d3wama_

PDB Entry: 3wam, 1.75 Å

PDB Description: Crystal structure of human LC3C_8-125

PDB Compounds: (A:) Microtubule-associated proteins 1A/1B light chain 3C

SCOPe Domain Sequences for d3wama_:

Sequence; same for both SEQRES and ATOM records:

>d3wama_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfkqrkslairqeevagirakfpnkipvvverypretflppldktkflvpqeltmtqfl
siirsrmvlrateafyllvnnkslvsmsatmaeiyrdykdedgfvymtyasqetf

Timeline for d3wama_:

• d3wama_ first appeared in SCOPe 2.03
  
• d3wama_ appears in SCOPe 2.04
  
• d3wama_ appears in SCOPe 2.06
  
• d3wama_ appears in the current release, SCOPe 2.08