Lineage for d1a8za_ (1a8z A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770978Protein Rusticyanin [49537] (1 species)
  7. 2770979Species Thiobacillus ferrooxidans [TaxId:920] [49538] (7 PDB entries)
  8. 2770988Domain d1a8za_: 1a8z A: [23020]
    complexed with cu1

Details for d1a8za_

PDB Entry: 1a8z (more details), 2.1 Å

PDB Description: structure determination of a 16.8kda copper protein rusticyanin at 2.1a resolution using anomalous scattering data with direct methods
PDB Compounds: (A:) rusticyanin

SCOPe Domain Sequences for d1a8za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8za_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]}
ldtswkeatlpqvkamlqkdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknp
tldipagatvdvtfintnkgfghsfditqktppfavmpvidpivagtgfspvpkdgkfgy
tnftwhptagtyyyvcqipghaatgmfgkivvk

SCOPe Domain Coordinates for d1a8za_:

Click to download the PDB-style file with coordinates for d1a8za_.
(The format of our PDB-style files is described here.)

Timeline for d1a8za_: