![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Rusticyanin [49537] (1 species) |
![]() | Species Thiobacillus ferrooxidans [TaxId:920] [49538] (7 PDB entries) |
![]() | Domain d1a8za_: 1a8z A: [23020] complexed with cu1 |
PDB Entry: 1a8z (more details), 2.1 Å
SCOPe Domain Sequences for d1a8za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8za_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} ldtswkeatlpqvkamlqkdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknp tldipagatvdvtfintnkgfghsfditqktppfavmpvidpivagtgfspvpkdgkfgy tnftwhptagtyyyvcqipghaatgmfgkivvk
Timeline for d1a8za_: