SCOPe 2.07: Domain d3waoa_: 3wao A:

Lineage for d3waoa_ (3wao A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187279] (32 PDB entries)

8. Domain d3waoa_: 3wao A: [230199]
   automated match to d3vtva_

Details for d3waoa_

PDB Entry: 3wao, 2.6 Å

PDB Description: crystal structure of atg13 lir-fused human lc3b_2-119

PDB Compounds: (A:) Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d3waoa_:

Sequence; same for both SEQRES and ATOM records:

>d3waoa_ d.15.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkfl
vpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvy
asqetf

Timeline for d3waoa_:

• d3waoa_ first appeared in SCOPe 2.03
  
• d3waoa_ appears in SCOPe 2.06
  
• d3waoa_ appears in the current release, SCOPe 2.08