![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
![]() | Protein automated matches [190358] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187279] (8 PDB entries) |
![]() | Domain d3waoa_: 3wao A: [230199] automated match to d3vtva_ |
PDB Entry: 3wao (more details), 2.6 Å
SCOPe Domain Sequences for d3waoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3waoa_ d.15.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkfl vpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvy asqetf
Timeline for d3waoa_: