Lineage for d3waob_ (3wao B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893478Family d.15.1.3: GABARAP-like [54253] (4 protein domains)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 1893500Protein automated matches [190358] (5 species)
    not a true protein
  7. 1893513Species Human (Homo sapiens) [TaxId:9606] [187279] (15 PDB entries)
  8. 1893534Domain d3waob_: 3wao B: [230196]
    automated match to d3vtva_

Details for d3waob_

PDB Entry: 3wao (more details), 2.6 Å

PDB Description: crystal structure of atg13 lir-fused human lc3b_2-119
PDB Compounds: (B:) Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d3waob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3waob_ d.15.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkfl
vpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvy
asqe

SCOPe Domain Coordinates for d3waob_:

Click to download the PDB-style file with coordinates for d3waob_.
(The format of our PDB-style files is described here.)

Timeline for d3waob_: