SCOPe 2.08: Domain d1a3za_: 1a3z A:

Lineage for d1a3za_ (1a3z A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Rusticyanin [49537] (1 species)

7. Species Thiobacillus ferrooxidans [TaxId:920] [49538] (7 PDB entries)

8. Domain d1a3za_: 1a3z A: [23019]
   complexed with cu1

Details for d1a3za_

PDB Entry: 1a3z, 1.9 Å

PDB Description: reduced rusticyanin at 1.9 angstroms

PDB Compounds: (A:) rusticyanin

SCOPe Domain Sequences for d1a3za_:

Sequence; same for both SEQRES and ATOM records:

>d1a3za_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]}
twkeatlpqvkamlekddgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknptle
ipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgytdf
twhptagtyyyvcqipghaatgmfgkivvk

Timeline for d1a3za_:

• d1a3za_ first appeared (with stable ids) in SCOP 1.55, called d1a3z__
  
• d1a3za_ appears in SCOPe 2.07