| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
| Protein Rusticyanin [49537] (1 species) |
| Species Thiobacillus ferrooxidans [TaxId:920] [49538] (7 PDB entries) |
| Domain d1a3za_: 1a3z A: [23019] complexed with cu1 |
PDB Entry: 1a3z (more details), 1.9 Å
SCOPe Domain Sequences for d1a3za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3za_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]}
twkeatlpqvkamlekddgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknptle
ipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgytdf
twhptagtyyyvcqipghaatgmfgkivvk
Timeline for d1a3za_: