Lineage for d4nvmb_ (4nvm B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333085Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2333086Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (205 PDB entries)
    Uniprot P00431
  8. 2333165Domain d4nvmb_: 4nvm B: [230189]
    automated match to d1kxna_
    complexed with 2o0, hem, mes, po4

Details for d4nvmb_

PDB Entry: 4nvm (more details), 1.51 Å

PDB Description: predicting protein conformational response in prospective ligand discovery
PDB Compounds: (B:) cytochrome c peroxidase

SCOPe Domain Sequences for d4nvmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nvmb_ a.93.1.1 (B:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4nvmb_:

Click to download the PDB-style file with coordinates for d4nvmb_.
(The format of our PDB-style files is described here.)

Timeline for d4nvmb_: