SCOPe 2.03: Domain d4nvob_: 4nvo B:

Lineage for d4nvob_ (4nvo B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
   Uniprot P00431

8. Domain d4nvob_: 4nvo B: [230187]
   automated match to d1kxna_
   complexed with 556, hem

Details for d4nvob_

PDB Entry: 4nvo, 1.71 Å

PDB Description: predicting protein conformational response in prospective ligand discovery

PDB Compounds: (B:) cytochrome c peroxidase

SCOPe Domain Sequences for d4nvob_:

Sequence; same for both SEQRES and ATOM records:

>d4nvob_ a.93.1.1 (B:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d4nvob_:

• d4nvob_ is new in SCOPe 2.03-stable
  
• d4nvob_ appears in SCOPe 2.04
  
• d4nvob_ appears in the current release, SCOPe 2.08