SCOPe 2.03: Domain d4ns1b_: 4ns1 B:

Lineage for d4ns1b_ (4ns1 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (23 species)
   not a true protein

7. Species Porphyromonas gingivalis [TaxId:431947] [230181] (2 PDB entries)

8. Domain d4ns1b_: 4ns1 B: [230182]
   automated match to d1lvuc_
   complexed with da, gol, so4

Details for d4ns1b_

PDB Entry: 4ns1, 1.64 Å

PDB Description: crystal structure of purine nucleoside phosphorylase from porphyromonas gingivalis atcc 33277, nysgrc target 30972

PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4ns1b_:

Sequence, based on SEQRES records:

>d4ns1b_ c.56.2.0 (B:) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
qsmklqeqhyheaasflssrlpgdaktaiilgsglgelaekienktvipyneiphfaqat
avghkgniiggilggtpvvamqgrfhyyegysmdqvtfpirvmkllgienlfvsnaaggi
ntsfkvgdlmiicdhinnlpnpligpnmdmfgvrfpdmtraydrefiakakgiaqelnip
vkegvyvgltgpsyetpaeykfwgqvggdaigmstvpevivarhtgirvfgmsvitnegy
hfaddfvndeqdviraanaasekmgaifarliaav

Sequence, based on observed residues (ATOM records):

>d4ns1b_ c.56.2.0 (B:) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
qsmklqeqhyheaasflssrlpgdaktaiilgsglgelaekienktvipyneiphfaqak
gniiggilggtpvvamqgrfhyyegysmdqvtfpirvmkllgienlfvsnaaggintsfk
vgdlmiicdhinnlpnpligpnmdmfgvrfpdmtraydrefiakakgiaqelnipvkegv
yvgltgpsyetpaeykfwgqvggdaigmstvpevivarhtgirvfgmsvitnegyhfadd
fvndeqdviraanaasekmgaifarliaav

Timeline for d4ns1b_:

• d4ns1b_ is new in SCOPe 2.03-stable
  
• d4ns1b_ appears in SCOPe 2.04
  
• d4ns1b_ appears in the current release, SCOPe 2.08, called d4ns1b1