Lineage for d4ns0a_ (4ns0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773134Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries)
  8. 2773137Domain d4ns0a_: 4ns0 A: [230180]
    automated match to d4lt7a_
    complexed with pio, so4

Details for d4ns0a_

PDB Entry: 4ns0 (more details), 1.8 Å

PDB Description: the c2a domain of rabphilin 3a in complex with pi(4,5)p2
PDB Compounds: (A:) rabphilin-3a

SCOPe Domain Sequences for d4ns0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ns0a_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklrtktl
rntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkanqrkn
fniclerv

SCOPe Domain Coordinates for d4ns0a_:

Click to download the PDB-style file with coordinates for d4ns0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ns0a_: