Lineage for d4nkgd_ (4nkg D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689945Superfamily a.2.6: HR1 repeat [46585] (1 family) (S)
  5. 2689946Family a.2.6.1: HR1 repeat [46586] (2 proteins)
    protein kinase effector domain
    this is a repeat family; one repeat unit is 1urf A:122-199 found in domain
  6. 2689952Protein automated matches [229723] (1 species)
    not a true protein
  7. 2689953Species Human (Homo sapiens) [TaxId:9606] [229724] (1 PDB entry)
  8. 2689955Domain d4nkgd_: 4nkg D: [230164]
    automated match to d4nkgb_
    complexed with hez

Details for d4nkgd_

PDB Entry: 4nkg (more details), 2.9 Å

PDB Description: Crystal structure of SspH1 LRR domain in complex PKN1 HR1b domain
PDB Compounds: (D:) Serine/threonine-protein kinase N1

SCOPe Domain Sequences for d4nkgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nkgd_ a.2.6.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkidiirmql
rralq

SCOPe Domain Coordinates for d4nkgd_:

Click to download the PDB-style file with coordinates for d4nkgd_.
(The format of our PDB-style files is described here.)

Timeline for d4nkgd_: