![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.6: HR1 repeat [46585] (1 family) ![]() |
![]() | Family a.2.6.1: HR1 repeat [46586] (2 proteins) protein kinase effector domain this is a repeat family; one repeat unit is 1urf A:122-199 found in domain |
![]() | Protein automated matches [229723] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [229724] (1 PDB entry) |
![]() | Domain d4nkgd_: 4nkg D: [230164] automated match to d4nkgb_ complexed with hez |
PDB Entry: 4nkg (more details), 2.9 Å
SCOPe Domain Sequences for d4nkgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nkgd_ a.2.6.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkidiirmql rralq
Timeline for d4nkgd_: