Lineage for d4m1dl2 (4m1d L:107-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519438Domain d4m1dl2: 4m1d L:107-211 [230161]
    Other proteins in same PDB: d4m1dh1, d4m1dh2, d4m1di1, d4m1di2
    automated match to d4m1dm2
    complexed with gol

Details for d4m1dl2

PDB Entry: 4m1d (more details), 1.8 Å

PDB Description: Crystal structure of anti-HIV-1 Fab 447-52D in complex with V3 cyclic peptide MN
PDB Compounds: (L:) Fab mAb 447-52D Light Chain

SCOPe Domain Sequences for d4m1dl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1dl2 b.1.1.0 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d4m1dl2:

Click to download the PDB-style file with coordinates for d4m1dl2.
(The format of our PDB-style files is described here.)

Timeline for d4m1dl2: