SCOPe 2.08: Domain d4mxfa_: 4mxf A:

Lineage for d4mxfa_ (4mxf A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)

8. Domain d4mxfa_: 4mxf A: [230158]
   automated match to d1kf3a_
   protein/RNA complex; complexed with au

Details for d4mxfa_

PDB Entry: 4mxf, 2.25 Å

PDB Description: X-ray structure of the adduct between bovine pancreatic ribonuclease and Auoxo6, a dinuclear gold(III) complex with -dioxo bridges linking the two metal centers

PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d4mxfa_:

Sequence; same for both SEQRES and ATOM records:

>d4mxfa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d4mxfa_:

• d4mxfa_ first appeared in SCOPe 2.03
  
• d4mxfa_ appears in SCOPe 2.07