Lineage for d4ltwa_ (4ltw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729636Species Ancestral gene [230150] (1 PDB entry)
  8. 2729637Domain d4ltwa_: 4ltw A: [230151]
    automated match to d3gn8a_
    complexed with 486, gol, so4, str

Details for d4ltwa_

PDB Entry: 4ltw (more details), 2.04 Å

PDB Description: Ancestral Ketosteroid Receptor-Progesterone-Mifepristone Complex
PDB Compounds: (A:) Ancestral Steroid Receptor 2

SCOPe Domain Sequences for d4ltwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ltwa_ a.123.1.1 (A:) automated matches {Ancestral gene}
snapslisilqaiepevvyagydntqpdttnyllsslnrlaekqlvsvvkwakalpgfrn
lhlddqmtliqyswmglmafamgwrsykhtngqmlyfapdlifneqrmqqsamydlcqgm
qqisqefvrlqvtqeeflcmkallllstvpkeglksqasfdemrmnyikelnraiakken
nsaqnwqrfyqltklldsmhdlvggllqfcfytfvqsqalsvefpemlveiisaqlpkvl
agmakpllfhk

SCOPe Domain Coordinates for d4ltwa_:

Click to download the PDB-style file with coordinates for d4ltwa_.
(The format of our PDB-style files is described here.)

Timeline for d4ltwa_: