SCOPe 2.07: Domain d4lsla2: 4lsl A:430-548

Lineage for d4lsla2 (4lsl A:430-548)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries)

8. Domain d4lsla2: 4lsl A:430-548 [230149]
   Other proteins in same PDB: d4lsla1, d4lslb_
   automated match to d2zd1a2
   complexed with 1yq

Details for d4lsla2

PDB Entry: 4lsl, 2.69 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with (e)- 3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy) phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4lsla2:

Sequence; same for both SEQRES and ATOM records:

>d4lsla2 c.55.3.0 (A:430-548) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqv

Timeline for d4lsla2:

• d4lsla2 first appeared in SCOPe 2.03
  
• d4lsla2 appears in SCOPe 2.06
  
• d4lsla2 appears in the current release, SCOPe 2.08