Lineage for d1nwob_ (1nwo B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 10917Protein Azurin [49530] (6 species)
  7. 11036Species Pseudomonas putida [TaxId:303] [49535] (2 PDB entries)
  8. 11040Domain d1nwob_: 1nwo B: [23014]

Details for d1nwob_

PDB Entry: 1nwo (more details), 1.92 Å

PDB Description: crystallographic study of azurin from pseudomonas putida

SCOP Domain Sequences for d1nwob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwob_ b.6.1.1 (B:) Azurin {Pseudomonas putida}
aeckvtvdstdqmsfntkdiaidkscktftvelthsgslpknvmghnlviskeadmqpia
tdglsagidkqylkdgdarviahtkvigagekdsvtfdvsklaagekygffcsfpghism
mkgtvtlk

SCOP Domain Coordinates for d1nwob_:

Click to download the PDB-style file with coordinates for d1nwob_.
(The format of our PDB-style files is described here.)

Timeline for d1nwob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nwoa_