SCOP 1.61: Domain d1nwoa_: 1nwo A:

Lineage for d1nwoa_ (1nwo A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas putida [TaxId:303] [49535] (2 PDB entries)

8. Domain d1nwoa_: 1nwo A: [23013]

Details for d1nwoa_

PDB Entry: 1nwo, 1.92 Å

PDB Description: crystallographic study of azurin from pseudomonas putida

SCOP Domain Sequences for d1nwoa_:

Sequence; same for both SEQRES and ATOM records:

>d1nwoa_ b.6.1.1 (A:) Azurin {Pseudomonas putida}
aeckvtvdstdqmsfntkdiaidkscktftvelthsgslpknvmghnlviskeadmqpia
tdglsagidkqylkdgdarviahtkvigagekdsvtfdvsklaagekygffcsfpghism
mkgtvtlk

Timeline for d1nwoa_:

• d1nwoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1nwoa_ appears in SCOP 1.59
  
• d1nwoa_ appears in SCOP 1.63
  
• d1nwoa_ appears in the current release, SCOPe 2.08