Lineage for d1nwoa_ (1nwo A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 55952Protein Azurin [49530] (6 species)
  7. 56071Species Pseudomonas putida [TaxId:303] [49535] (2 PDB entries)
  8. 56074Domain d1nwoa_: 1nwo A: [23013]

Details for d1nwoa_

PDB Entry: 1nwo (more details), 1.92 Å

PDB Description: crystallographic study of azurin from pseudomonas putida

SCOP Domain Sequences for d1nwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwoa_ b.6.1.1 (A:) Azurin {Pseudomonas putida}
aeckvtvdstdqmsfntkdiaidkscktftvelthsgslpknvmghnlviskeadmqpia
tdglsagidkqylkdgdarviahtkvigagekdsvtfdvsklaagekygffcsfpghism
mkgtvtlk

SCOP Domain Coordinates for d1nwoa_:

Click to download the PDB-style file with coordinates for d1nwoa_.
(The format of our PDB-style files is described here.)

Timeline for d1nwoa_: